General Information

  • ID:  hor006978
  • Uniprot ID:  P22301??20-178)
  • Protein name:  Interleukin-10
  • Gene name:  Reg1
  • Organism:  Homo sapiens
  • Family:  IL-10 family
  • Source:  Animal
  • Expression:  Produced by a variety of cell lines; including T-cells; macrophages; mast cells and other cell types.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0005576 extracellular region; GO:0005615 extracellular space
  • GO BP:  GO:0046983 protein dimerization activity; GO:0005125 cytokine activity; GO:0005141 interleukin-10 receptor binding; GO:0008083 growth factor activity
  • GO CC:  GO:0032689 negative regulation of type II interferon production; GO:1904706 negative regulation of vascular associated smooth muscle cell proliferation; GO:0051045 negative regulation of membrane protein ectodomain proteolysis; GO:0030886 negative regulation of myeloid dendritic cell activation; GO:0042130 negative regulation of T cell proliferation; GO:1903377 negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway; GO:0045019 negative regulation of nitric oxide biosynthetic process; GO:0045930 negative regulation of mitotic cell cycle; GO:0071392 cellular response to estradiol stimulus; GO:0045191 regulation of isotype switching; GO:0032720 negative regulation of tumor necrosis factor production; GO:0045347 negative regulation of MHC class II biosynthetic process; GO:0002237 response to molecule of bacterial origin; GO:0050807 regulation of synapse organization; GO:0060670 branching involved in labyrinthine layer morphogenesis; GO:0071222 cellular

Sequence Information

  • Sequence:  PGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
  • Length:  159
  • Propeptide:  MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
  • Signal peptide:  MHSSALLCCLVLLTGVRA
  • Modification:  T57 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA